Protein Info for OKGIIK_01235 in Rhodanobacter sp. FW510-T8

Annotation: Glycosyl transferases group 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 PF13579: Glyco_trans_4_4" amino acids 19 to 160 (142 residues), 36.6 bits, see alignment E=1.2e-12 PF13439: Glyco_transf_4" amino acids 19 to 158 (140 residues), 40 bits, see alignment E=8.9e-14 PF00534: Glycos_transf_1" amino acids 196 to 347 (152 residues), 98.3 bits, see alignment E=7.4e-32 PF13692: Glyco_trans_1_4" amino acids 197 to 342 (146 residues), 97.9 bits, see alignment E=1.4e-31

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>OKGIIK_01235 Glycosyl transferases group 1 (Rhodanobacter sp. FW510-T8)
MASRKRILLVLSYYHPYISGISEYAKMLAEGLAQHHDITVLTGRHLDTLPTREEIGGVTI
VRAKPLLFMHKGYISLDLALQFRRLARAADVINFHLPMLDAAWLTHLAPRCARFITTYQC
DVQPVGGWIDRLAVGAVNLGSRTCIRRSEKVVALSHDYAAGSNILSGETVPIAEGYAPIK
DMGLPASARIGDDGAFPVIGFLGRFVAEKGIDVLIRAFERVRLRYPSARLLLGGDYKTVA
GGSIYPQLKASIDALGDRVELLGRIEEADLPNFYARLDVFVLPSINAYEAFGMVQVEAML
AGVPAVASDMRGVRVPVQLTGVGSLAPPGSDDGLATAIVDAIAPEQRCDRETVRQTALKI
FSNQAFIERYLALIDSDAT