Protein Info for OKGIIK_01175 in Rhodanobacter sp. FW510-T8

Name: rfbB
Annotation: dTDP-glucose 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 10 to 181 (172 residues), 50.9 bits, see alignment E=4.3e-17 TIGR01181: dTDP-glucose 4,6-dehydratase" amino acids 11 to 343 (333 residues), 501.3 bits, see alignment E=5e-155 PF02719: Polysacc_synt_2" amino acids 11 to 120 (110 residues), 34.6 bits, see alignment E=4.3e-12 PF16363: GDP_Man_Dehyd" amino acids 12 to 329 (318 residues), 316.5 bits, see alignment E=9.4e-98 PF01370: Epimerase" amino acids 12 to 257 (246 residues), 227 bits, see alignment E=8.6e-71 PF01073: 3Beta_HSD" amino acids 12 to 237 (226 residues), 33.2 bits, see alignment E=1e-11 PF07993: NAD_binding_4" amino acids 56 to 193 (138 residues), 26.3 bits, see alignment E=1.4e-09

Best Hits

Swiss-Prot: 78% identical to RMLB_XANCB: dTDP-glucose 4,6-dehydratase (rfbB) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K01710, dTDP-glucose 4,6-dehydratase [EC: 4.2.1.46] (inferred from 81% identity to psu:Psesu_2450)

MetaCyc: 60% identical to dTDP-glucose 4,6-dehydratase 2 (Escherichia coli K-12 substr. MG1655)
dTDP-glucose 4,6-dehydratase. [EC: 4.2.1.46]

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.46

Use Curated BLAST to search for 4.2.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>OKGIIK_01175 dTDP-glucose 4,6-dehydratase (Rhodanobacter sp. FW510-T8)
MNESSTRSKTLLVTGGAGFIGANFVLQAVADGLQVVNLDKLTYAGNPDTLASLHGNERHV
FVHGDIGDRTLVARLLAEHRPDAIVNFAAESHVDRSIDGPAEFVQTNVVGTLGLLEGARD
YWRGLAGSARKAFRFLHVSTDEVYGSLGADGKFTETTPYAPNSPYSASKAASDHLVRAFH
HTYGLPVLTTNCSNNYGPYQFPEKLIPLVIQKALAGEALPVYGDGKNIRDWLFVGDHCSA
IRRVLDAGRVGETYNVGGNAERENIAVVKTICALLDGRRPPADGRPRESLITYVRDRPGH
DRRYAIDSSKLQRELGWQPSQTFESGIAATVDWYLDHQPWVQRVLDGSYRMERLGA