Protein Info for OKGIIK_00815 in Rhodanobacter sp. FW510-T8

Annotation: GNAT family acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 PF00583: Acetyltransf_1" amino acids 90 to 172 (83 residues), 32.4 bits, see alignment E=4.9e-12

Best Hits

Swiss-Prot: 59% identical to ATSE4_PSEAE: Acetyltransferase PA5475 (PA5475) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 59% identity to pag:PLES_58711)

Predicted SEED Role

"Acetyl-CoA synthetase (ADP-forming) alpha and beta chains, putative" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (190 amino acids)

>OKGIIK_00815 GNAT family acetyltransferase (Rhodanobacter sp. FW510-T8)
MSSTHQTGHGSPAFTPFGAIEGTHWIETLADGSPVLVRPLRPDDRQRETDFINRLSGEAC
RFRFLGGMKGANPALIDSLMNVDARRRLAFVALAHDNGELREVGVSRYAASADDKHCECA
VTVADDWRHRGLAVLLMRRLIEAARKNGFRQMFSIDAAGNEPMRELAAYLGFTRRLDPDD
AAQVIHTLDL