Protein Info for OKGIIK_00780 in Rhodanobacter sp. FW510-T8

Name: hppD
Annotation: 4-hydroxyphenylpyruvate dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF14696: Glyoxalase_5
  • amino acids 14 to 154 (141 residues), 189.2 bits, E=5.8e-60
• TIGR01263: 4-hydroxyphenylpyruvate dioxygenase
  • amino acids 22 to 364 (343 residues), 376.6 bits, E=8e-117
• PF00903: Glyoxalase
  • amino acids 172 to 282 (111 residues), 60.9 bits, E=2.5e-20
• PF13669: Glyoxalase_4
  • amino acids 185 to 277 (93 residues), 36.6 bits, E=7.5e-13

Best Hits

KEGG orthology group: K00457, 4-hydroxyphenylpyruvate dioxygenase [EC: 1.13.11.27] (inferred from 86% identity to xca:xccb100_0470)

Predicted SEED Role

"4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)" in subsystem Aromatic amino acid degradation or Homogentisate pathway of aromatic compound degradation or Plastoquinone Biosynthesis or Tocopherol Biosynthesis (EC 1.13.11.27)

MetaCyc Pathways

• L-tyrosine degradation I (4/5 steps found)
• superpathway of plastoquinol biosynthesis (3/5 steps found)
• plastoquinol-9 biosynthesis I (1/3 steps found)
• vitamin E biosynthesis (tocopherols) (1/7 steps found)
• L-phenylalanine degradation IV (mammalian, via side chain) (2/9 steps found)

KEGG Metabolic Maps

• Phenylalanine metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.27

Protein Sequence (364 amino acids)

>OKGIIK_00780 4-hydroxyphenylpyruvate dioxygenase (Rhodanobacter sp. FW510-T8)
MNAQPNPGMQVTTFENPMGIDGFEFVEFAAPAGRAGELHALFKRMGFSAVLKHKRRPITV
YRQNGVNFLLNEDPDSFAADFAAKHGPSACGFAIRFRKPAAGVLQAVLGNGGEAVTDKEA
SKAVNAPVVKGIGDCMLYLVDRYGSAGSIYDGDYAPIEGAGQNPKGFGLTFIDHLTHNLY
FGNMQKWSDYYEKLFNFREIRYFDIKGAKTGLVSKAMTAPDGIVRIPLNESSDPKSQINE
YLDAYHGEGIQHIACFTDDIYATVEQMHAAGVEFLDTPDTYFDVIDLRIPDHGEDVPRLA
RNKILIDADPETKQRKLLQIFTQNAIGPIFFEIIQRKGNEGFGEGNFQALFESIERDQMK
RGVL