Protein Info for OKGIIK_00660 in Rhodanobacter sp. FW510-T8

Annotation: Type III pantothenate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 TIGR00671: pantothenate kinase, type III" amino acids 3 to 236 (234 residues), 88.5 bits, see alignment E=3e-29 PF03309: Pan_kinase" amino acids 3 to 197 (195 residues), 147.3 bits, see alignment E=2.8e-47

Best Hits

Predicted SEED Role

"Pantothenate kinase type III, CoaX-like (EC 2.7.1.33)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.33)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>OKGIIK_00660 Type III pantothenate kinase (Rhodanobacter sp. FW510-T8)
MRLLLDLGNTRLKWALQVQADGWLARGAVDWREDAARVLEAAWAGLPAPLRVVGASVVDA
AREAQVAAVAQRCFGRAPEWLRTPSGACGVRNAYAEPARLGVDRFLVMVAAHAGGHAPCV
LAGVGTALTLDALAADGQHLGGLIAPGPQLMQQSLRDATAQVRPERPGAIVDLADNTADA
VASGCWQAAAALVERFALRAAPRLGATPELILGGGDAAQLLPLLSLPARLSQDGVLRGLA
VWARAFEAGGAL