Protein Info for OKFHMN_28655 in Escherichia coli ECRC100
Name: cls
Annotation: cardiolipin synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to YCIU_ECO24: UPF0263 protein YciU (yciU) from Escherichia coli O139:H28 (strain E24377A / ETEC)
KEGG orthology group: K09901, hypothetical protein (inferred from 100% identity to eco:b1248)Predicted SEED Role
"FIG002901: hypothetical protein co-occurring with Cardiolipin synthetase"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (109 amino acids)
>OKFHMN_28655 cardiolipin synthase (Escherichia coli ECRC100) MDMDLNNRLTEDETLEQAYDIFLELAADNLDPADVLLFNLQFEERGGAELFDPAEDWQEH VDFDLNPDFFAEVVIGLADSEDGEINDVFARILLCREKDHKLCHIIWRE