Protein Info for OKFHMN_28655 in Escherichia coli ECRC100

Name: cls
Annotation: cardiolipin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 PF04269: DUF440" amino acids 8 to 109 (102 residues), 156.2 bits, see alignment E=1.3e-50

Best Hits

Swiss-Prot: 100% identical to YCIU_ECO24: UPF0263 protein YciU (yciU) from Escherichia coli O139:H28 (strain E24377A / ETEC)

KEGG orthology group: K09901, hypothetical protein (inferred from 100% identity to eco:b1248)

Predicted SEED Role

"FIG002901: hypothetical protein co-occurring with Cardiolipin synthetase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (109 amino acids)

>OKFHMN_28655 cardiolipin synthase (Escherichia coli ECRC100)
MDMDLNNRLTEDETLEQAYDIFLELAADNLDPADVLLFNLQFEERGGAELFDPAEDWQEH
VDFDLNPDFFAEVVIGLADSEDGEINDVFARILLCREKDHKLCHIIWRE