Protein Info for OKFHMN_28180 in Escherichia coli ECRC100

Name: ompT
Annotation: omptin family outer membrane protease OmpT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF01278: Omptin" amino acids 28 to 317 (290 residues), 433.3 bits, see alignment E=1.7e-134

Best Hits

Swiss-Prot: 100% identical to OMPT_ECO57: Protease 7 (ompT) from Escherichia coli O157:H7

KEGG orthology group: K01355, omptin [EC: 3.4.23.49] (inferred from 99% identity to eco:b0565)

MetaCyc: 99% identical to DLP12 prophage; omptin family outer membrane protease OmpT (Escherichia coli K-12 substr. MG1655)
Omptin. [EC: 3.4.23.49]

Predicted SEED Role

"Protease VII (Omptin) precursor (EC 3.4.23.49)" (EC 3.4.23.49)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.49

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>OKFHMN_28180 omptin family outer membrane protease OmpT (Escherichia coli ECRC100)
MRAKLLGIVLTTPIAISSFASTETLSFTPDNINADISLGTLSGKTKERVYLAEEGGRKVS
QLDWKFNNAAIIKGAINWDLMPQISIGAAGWTTLGSRGGNMVDQDWMDSSNPGTWTDESR
HPDTQLNYANEFDLNIKGWLLNEPNYRLGLMAGYQESRYSFTARGGSYIYSSEEGFRDDI
GSFPNGERAIGYKQRFKMPYIGLTGSYRYEDFELGGTFKYSGWVEASDNDEHYDPGKRIT
YRSKVKDQNYYSVSVNAGYYVTPNAKVYVEGTWNRVTNKKGNTSLYDHNDNTSDYSKNGA
GIENYNFITTAGLKYTF