Protein Info for OKFHMN_26850 in Escherichia coli ECRC100

Name: nudG
Annotation: CTP pyrophosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 PF00293: NUDIX" amino acids 4 to 125 (122 residues), 82.5 bits, see alignment E=2.8e-27 PF14815: NUDIX_4" amino acids 7 to 123 (117 residues), 75.6 bits, see alignment E=2.8e-25

Best Hits

Swiss-Prot: 98% identical to NUDG_ECOLI: CTP pyrophosphohydrolase (nudG) from Escherichia coli (strain K12)

KEGG orthology group: K08320, CTP pyrophosphohydrolase [EC: 3.6.1.-] (inferred from 98% identity to eco:b1759)

MetaCyc: 98% identical to 5-hydroxy-CTP diphosphatase (Escherichia coli K-12 substr. MG1655)
RXN0-6957 [EC: 3.6.1.56]; 3.6.1.- [EC: 3.6.1.56]; RXN0-7291 [EC: 3.6.1.56]

Predicted SEED Role

"5-methyl-dCTP pyrophosphohydrolase (EC 3.6.1.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.- or 3.6.1.56

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (135 amino acids)

>OKFHMN_26850 CTP pyrophosphohydrolase (Escherichia coli ECRC100)
MKMIEVVAAIIERDGKILLAQRPAQSDQAGLWEFAGGKVEPDESQQQALVRELNEELGIE
ATVGEYVASHQREVSGRIIHLHAWHVPDFHGTLQAHEHQALVWCSPEEALQYPLAPADIP
LLEAFMALRAARPAD