Protein Info for OKFHMN_26760 in Escherichia coli ECRC100

Name: ydjI
Annotation: Uncharacterized protein YdjI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 TIGR00167: ketose-bisphosphate aldolase" amino acids 1 to 277 (277 residues), 324.2 bits, see alignment E=3.8e-101 PF01116: F_bP_aldolase" amino acids 10 to 276 (267 residues), 300.5 bits, see alignment E=6.9e-94

Best Hits

Swiss-Prot: 100% identical to YDJI_ECOLI: Uncharacterized protein YdjI (ydjI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1773)

MetaCyc: 100% identical to L-glycero-L-galacto-octuluronate-1-phosphate aldolase (Escherichia coli K-12 substr. MG1655)
RXN-21532

Predicted SEED Role

"Putative aldolase YdjI"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>OKFHMN_26760 Uncharacterized protein YdjI (Escherichia coli ECRC100)
MLADIRYWENDATNKRYAIAHFNVWNAEMLMGVIDAAEEAKSPVIISFGTGFVGNTSFED
FSHMMVSMAQKATVPVITHWDHGRSMEIIHNAWTHGMNSLMRDASAFDFEENIRLTKEAV
DFFHPLGIPVEAELGHVGNETVYEEALAGYHYTDPDQAAEFVERTGCDSLAVAIGNQHGV
YTSEPQLNFEVVKRVRDAVSVPLVLHGASGISDADIKTAISLGIAKINIHTELCQAAMVA
VKENQDQPFLHLEREVRKAVKERALEKIKLFGSDGKAE