Protein Info for OKFHMN_26660 in Escherichia coli ECRC100

Name: gAF
Annotation: GAF domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 PF13185: GAF_2" amino acids 17 to 155 (139 residues), 39 bits, see alignment E=1.4e-13 PF01590: GAF" amino acids 19 to 154 (136 residues), 36.2 bits, see alignment E=1.2e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 172 to 280 (109 residues), 99.1 bits, see alignment E=1.1e-32 PF00990: GGDEF" amino acids 175 to 280 (106 residues), 111.8 bits, see alignment E=4.4e-36

Best Hits

Swiss-Prot: 98% identical to DGCP_ECOLI: Diguanylate cyclase DgcP (dgcP) from Escherichia coli (strain K12)

KEGG orthology group: K13069, diguanylate cyclase [EC: 2.7.7.65] (inferred from 98% identity to eco:b1794)

MetaCyc: 98% identical to diguanylate cyclase DgcP (Escherichia coli K-12 substr. MG1655)
Diguanylate kinase. [EC: 2.7.7.65]

Predicted SEED Role

"FIG00638308: hypothetical protein"

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.65

Use Curated BLAST to search for 2.7.7.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (282 amino acids)

>OKFHMN_26660 GAF domain (Escherichia coli ECRC100)
VSDQIIARISQSLAKEQSLESLVRQLLEMLEMVTDMESTYLTKVDVEARLQHIMFARNSQ
KMHIPENFTVSWDYSLCKRAIDKNCFFSDEVPDRWGDCIAARNLGITTFLSTPIHLPDGS
FYGTLCAASSEKRQWSERAEQVLQLFAGLIAQYIQKEALVEQLREANAALIAQSYTDSLT
GLPNRRAIFENLTTLFSLARHLNQKIMIAFIDLDNFKLINDRFGHNSGDLFLIQVGERLN
TLQQNGEVIGRLGGDEFLVVSLNNENADISSLRERIQQQIRG