Protein Info for OKFHMN_26390 in Escherichia coli ECRC100

Name: yobB
Annotation: Uncharacterized protein YobB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 PF00795: CN_hydrolase" amino acids 5 to 113 (109 residues), 70.3 bits, see alignment E=8.6e-24 amino acids 116 to 208 (93 residues), 29 bits, see alignment E=3.4e-11

Best Hits

Swiss-Prot: 100% identical to YOBB_ECOLI: Uncharacterized protein YobB (yobB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1843)

Predicted SEED Role

"Putative amidohydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>OKFHMN_26390 Uncharacterized protein YobB (Escherichia coli ECRC100)
MSFWKVAAAQYEPRKTSLTEQVAHHLEFVRAAARQQCQLLVFPSLSLLGCDYSRRALPAP
PDLSLLDPLCYAATTWRMTIIAGLPVEYNDRFIRGIAVFAPWRKTPGIYHQSHGACLGRR
SRTITVVDEQPQGMDMDPTCSLFTTGQCLGEPDLLASARRLQFFSHQYSIAVLMANARGN
SALWDEHGRLIVRADRGSLLLVGQRSSQGWQGDIIPLR