Protein Info for OKFHMN_26265 in Escherichia coli ECRC100

Name: ruvC
Annotation: crossover junction endodeoxyribonuclease RuvC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 TIGR00228: crossover junction endodeoxyribonuclease RuvC" amino acids 4 to 159 (156 residues), 291.7 bits, see alignment E=6.3e-92 PF02075: RuvC" amino acids 4 to 150 (147 residues), 230.9 bits, see alignment E=2.7e-73

Best Hits

Swiss-Prot: 100% identical to RUVC_ECO27: Crossover junction endodeoxyribonuclease RuvC (ruvC) from Escherichia coli O127:H6 (strain E2348/69 / EPEC)

KEGG orthology group: K01159, crossover junction endodeoxyribonuclease RuvC [EC: 3.1.22.4] (inferred from 100% identity to eco:b1863)

MetaCyc: 100% identical to crossover junction endodeoxyribonuclease RuvC (Escherichia coli K-12 substr. MG1655)
3.1.22.4-RXN [EC: 3.1.21.10]

Predicted SEED Role

"Crossover junction endodeoxyribonuclease RuvC (EC 3.1.22.4)" in subsystem DNA-replication or RuvABC plus a hypothetical (EC 3.1.22.4)

Isozymes

Compare fitness of predicted isozymes for: 3.1.22.4

Use Curated BLAST to search for 3.1.21.10 or 3.1.22.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (173 amino acids)

>OKFHMN_26265 crossover junction endodeoxyribonuclease RuvC (Escherichia coli ECRC100)
MAIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQ
PDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKS
QVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAMQMSESRLNLARGRLR