Protein Info for OKFHMN_26240 in Escherichia coli ECRC101

Name: yecD
Annotation: hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 PF00857: Isochorismatase" amino acids 9 to 183 (175 residues), 138.3 bits, see alignment E=1.5e-44

Best Hits

Swiss-Prot: 100% identical to YECD_ECO57: Uncharacterized isochorismatase family protein YecD (yecD) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b1867)

Predicted SEED Role

"Nicotinamidase/isochorismatase family protein" in subsystem NAD and NADP cofactor biosynthesis global

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (188 amino acids)

>OKFHMN_26240 hydrolase (Escherichia coli ECRC101)
MLELNAKTTALVVIDLQEGILPFAGGPHTADEVVNRAGKLAAKFRASGQPVFLVRVGWSA
DYAEALKQPVDAPSPAKVLPENWWQHPAALGATDSDIEIIKRQWGAFYGTDLELQLRRRG
IDTIVLCGISTNIGVESTARNAWELGFNLVIAEDACSAASAEQHNNSINHIYPRIARVRS
VEEILNAL