Protein Info for OKFHMN_25850 in Escherichia coli ECRC100

Name: insI1
Annotation: IS30 family transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 PF13936: HTH_38" amino acids 19 to 59 (41 residues), 67.1 bits, see alignment 1.4e-22 PF00665: rve" amino acids 190 to 281 (92 residues), 52.2 bits, see alignment E=9.7e-18

Best Hits

Swiss-Prot: 100% identical to INSI4_ECOLI: Transposase InsI for insertion sequence element IS30D (insI4) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ece:Z2993)

MetaCyc: 99% identical to IS30 transposase (Escherichia coli K-12 substr. MG1655)
2.7.7.-

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>OKFHMN_25850 IS30 family transposase (Escherichia coli ECRC100)
MLRDTGGIKPHERKRAVAHLTLSEREEIRAGLSAKMSIRAIATALNRSPSTISREVQRNR
GRRYYKAVDANNRANRMAKRPKPCLLDQNLPLRKLVLEKLEMKWSPEQISGWLRRTKPRQ
KTLRISPETIYKTLYFRSREALHHLNIQHLRRSHSLRHGRRHTRKGERGTINIVNGTPIH
ERSRNIDNRRSLGHWEGDLVSGTKNSHIATLVDRKSRYTIILRLRGKDSVSVNQALTDKF
LSLPSELRKSLTWDRGMELARHLEFTVSTGVKVYFCDPQSPWQRGTNENTNGLIRQYFPK
KTCLAQYTQHEDLVAAQLNNRPRKTLKFKTPKEIIERGVALTD