Protein Info for OKFHMN_25820 in Escherichia coli ECRC100

Name: uvrC
Annotation: excinuclease ABC subunit UvrC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 PF00072: Response_reg" amino acids 4 to 116 (113 residues), 108.6 bits, see alignment E=3e-35 PF00196: GerE" amino acids 149 to 204 (56 residues), 74 bits, see alignment E=9e-25

Best Hits

Swiss-Prot: 100% identical to UVRY_ECOL6: Response regulator UvrY (uvrY) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K07689, two-component system, NarL family, invasion response regulator UvrY (inferred from 99% identity to eco:b1914)

Predicted SEED Role

"BarA-associated response regulator UvrY (= GacA = SirA)" in subsystem Pseudomonas quinolone signal PQS or Quorum sensing regulation in Pseudomonas or Type III secretion system orphans

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>OKFHMN_25820 excinuclease ABC subunit UvrC (Escherichia coli ECRC100)
LINVLLVDDHELVRAGIRRILEDIKGIKVVGEASCGEDAVKWCRANAVDVVLMDMSMPGI
GGLEATRKIARSTADVKIIMLTVHTENPLPAKVMQAGAAGYLSKGAAPQEVVSAIRSVYS
GQRYIASDIAQQMALSQIEPEKTESPFASLSERELQIMLMITKGQKVNEISEQLNLSPKT
VNSYRYRMFSKLNIHGDVELTHLAIRHGLCNAETLSSQ