Protein Info for OKFHMN_25600 in Escherichia coli ECRC101

Name: dcm
Annotation: DNA-cytosine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 PF18284: DNA_meth_N" amino acids 19 to 75 (57 residues), 68.6 bits, see alignment 3.9e-23 PF00145: DNA_methylase" amino acids 87 to 448 (362 residues), 259.5 bits, see alignment E=5.5e-81 TIGR00675: DNA (cytosine-5-)-methyltransferase" amino acids 89 to 450 (362 residues), 350.4 bits, see alignment E=6.7e-109

Best Hits

Swiss-Prot: 100% identical to DCM_ECOLI: DNA-cytosine methyltransferase (dcm) from Escherichia coli (strain K12)

KEGG orthology group: K00558, DNA (cytosine-5-)-methyltransferase [EC: 2.1.1.37] (inferred from 100% identity to eco:b1961)

MetaCyc: 100% identical to DNA-cytosine methyltransferase (Escherichia coli K-12 substr. MG1655)
DNA (cytosine-5-)-methyltransferase. [EC: 2.1.1.37]

Predicted SEED Role

"DNA-cytosine methyltransferase (EC 2.1.1.37)" (EC 2.1.1.37)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (472 amino acids)

>OKFHMN_25600 DNA-cytosine methyltransferase (Escherichia coli ECRC101)
MQENISVTDSYSTGNAAQAMLEKLLQIYDVKTLVAQLNGVGENHWSAAILKRALANDSAW
HRLSEKEFAHLQTLLPKPPAHHPHYAFRFIDLFAGIGGIRRGFESIGGQCVFTSEWNKHA
VRTYKANHYCDPATHHFNEDIRDITLSHKEGVSDEAAAEHIRQHIPEHDVLLAGFPCQPF
SLAGVSKKNSLGRAHGFACDTQGTLFFDVVRIIDARRPAMFVLENVKNLKSHDQGKTFRI
IMQTLDELGYDVADAEDNGPDDPKIIDGKHFLPQHRERIVLVGFRRDLNLKADFTLRDIS
ECFPAQRVTLAQLLDPMVEAKYILTPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVT
RTLSARYYKDGAEILIDRGWDMATGEKDFDDPLNQQHRPRRLTPRECARLMGFEAPGEAK
FRIPVSDTQAYRQFGNSVVVPVFAAVAKLLEPKIKQAVALRQQEAQHGRRSR