Protein Info for OKFHMN_25560 in Escherichia coli ECRC101

Name: hiuH
Annotation: hydroxyisourate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02962: hydroxyisourate hydrolase
  • amino acids 27 to 137 (111 residues), 150.2 bits, E=1.3e-48
• PF00576: Transthyretin
  • amino acids 29 to 136 (108 residues), 133.5 bits, E=2.3e-43

Best Hits

Swiss-Prot: 100% identical to HIUH_ECO57: 5-hydroxyisourate hydrolase (hiuH) from Escherichia coli O157:H7

KEGG orthology group: K07127, 5-hydroxyisourate hydrolase [EC: 3.5.2.17] (inferred from 98% identity to ecj:JW1953)

MetaCyc: 98% identical to hydroxyisourate hydrolase / transthyretin-related protein (Escherichia coli K-12 substr. MG1655)
Hydroxyisourate hydrolase. [EC: 3.5.2.17]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of purines degradation in plants (13/18 steps found)
• ureide biosynthesis (5/7 steps found)
• urate conversion to allantoin I (1/3 steps found)
• urate conversion to allantoin II (1/3 steps found)
• urate conversion to allantoin III (1/3 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.17

Protein Sequence (137 amino acids)

>OKFHMN_25560 hydroxyisourate hydrolase (Escherichia coli ECRC101)
MLKRYLVLSVVTAAFSLPSLVYAAQQNILSVHILNQQTGKPAADVTVTLEKKADNGWLQL
NTAKTDKDGRIKALWPEQTATTGDYRVVFKTGDYFKKQNLESFFPEIPVEFHINKVNEHY
HVPLLLSQYGYSTYRGS