Protein Info for OKFHMN_24375 in Escherichia coli ECRC101

Name: wcaJ
Annotation: undecaprenyl-phosphate glucose phosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 transmembrane" amino acids 16 to 36 (21 residues), see Phobius details amino acids 42 to 69 (28 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 113 to 136 (24 residues), see Phobius details amino acids 279 to 300 (22 residues), see Phobius details TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 24 to 464 (441 residues), 498.3 bits, see alignment E=2.7e-153 TIGR03023: undecaprenyl-phosphate glucose phosphotransferase" amino acids 25 to 464 (440 residues), 545.4 bits, see alignment E=1.5e-167 PF13727: CoA_binding_3" amino acids 65 to 238 (174 residues), 149.8 bits, see alignment E=8.6e-48 PF02397: Bac_transf" amino acids 274 to 457 (184 residues), 236.9 bits, see alignment E=1.2e-74

Best Hits

Swiss-Prot: 100% identical to WCAJ_ECOLI: UDP-glucose:undecaprenyl-phosphate glucose-1-phosphate transferase (wcaJ) from Escherichia coli (strain K12)

KEGG orthology group: K03606, putative colanic acid biosysnthesis UDP-glucose lipid carrier transferase (inferred from 100% identity to eco:b2047)

MetaCyc: 100% identical to UDP-glucose:undecaprenyl-phosphate glucose-1-phosphate transferase (Escherichia coli K-12 substr. MG1655)
RXN-11791 [EC: 2.7.8.31]

Predicted SEED Role

"Colanic acid biosynthsis UDP-glucose lipid carrier transferase WcaJ" in subsystem Colanic acid biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>OKFHMN_24375 undecaprenyl-phosphate glucose phosphotransferase (Escherichia coli ECRC101)
MTNLKKRERAKTNASLISMVQRFSDITIMFAGLWLVCEVSGLSFLYMHLLVALITLVVFQ
MLGGITDFYRSWRGVRAATEFALLLQNWTLSVIFSAGLVAFNNDFDTQLKIWLAWYGLTS
IGLVVCRSCIRIGAGWLRNHGYNKRMVAVAGDLAAGQMLMESFRNQPWLGFEVVGVYHDP
KLGGVSNDWAGNLQQLVEDAKAGKIHNVYIAMQMCDGARVKKLVHQLADTTCSVLLIPDV
FTFNILHSRLEEMNGVPVVPLYDTPLSGVNRLLKRAEDIVLATLILLLISPVLCCIALAV
KLSSPGPVIFRQTRYGMDGKPIKVWKFRSMKVMENDKVVTQATQNDPRVTKVGNFLRRTS
LDELPQFINVLTGGMSIVGPRPHAVAHNEQYRQLIEGYMLRHKVKPGITGWAQINGWRGE
TDTLEKMEKRVEFDLEYIREWSVWFDIKIVFLTVFKGFVNKAAY