Protein Info for OKFHMN_24265 in Escherichia coli ECRC100

Annotation: Putative diguanylate cyclase YegE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 124 to 147 (24 residues), see Phobius details PF05231: MASE1" amino acids 19 to 146 (128 residues), 67.6 bits, see alignment E=5.2e-23

Best Hits

Predicted SEED Role

"FIG00639229: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (177 amino acids)

>OKFHMN_24265 Putative diguanylate cyclase YegE (Escherichia coli ECRC100)
MSKQSQHVLIALPHPLLHLVSLGLVSFIFTLFSLELSQFGTQLAPLWFPTSIMMVAFYRH
AGRMWPGIALSCSLGNIAASILLFSTSSLNMTCTTINIVEAVVGAVLLRKLLPWYNPLQN
LADWLRLALGSAIVPPLLGGVLVVLLTPGDDPHQGIFDMGTVRIHRRSGTGAAGIVI