Protein Info for OKFHMN_24140 in Escherichia coli ECRC100

Name: gatD
Annotation: galactitol-1-phosphate 5-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 transmembrane" amino acids 165 to 184 (20 residues), see Phobius details PF08240: ADH_N" amino acids 25 to 132 (108 residues), 95 bits, see alignment E=4.7e-31 PF01262: AlaDh_PNT_C" amino acids 157 to 216 (60 residues), 31.5 bits, see alignment E=1.8e-11 PF00107: ADH_zinc_N" amino acids 172 to 305 (134 residues), 87.3 bits, see alignment E=1.3e-28

Best Hits

Swiss-Prot: 100% identical to GATD_ECOLI: Galactitol 1-phosphate 5-dehydrogenase (gatD) from Escherichia coli (strain K12)

KEGG orthology group: K00094, galactitol-1-phosphate 5-dehydrogenase [EC: 1.1.1.251] (inferred from 100% identity to eco:b2091)

MetaCyc: 100% identical to galactitol-1-phosphate 5-dehydrogenase (Escherichia coli K-12 substr. MG1655)
Galactitol-1-phosphate 5-dehydrogenase. [EC: 1.1.1.251]

Predicted SEED Role

"Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)" in subsystem D-Tagatose and Galactitol Utilization (EC 1.1.1.251)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.251

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (346 amino acids)

>OKFHMN_24140 galactitol-1-phosphate 5-dehydrogenase (Escherichia coli ECRC100)
MKSVVNDTDGIVRVAESVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHE
FSGYIDAVGSGVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEY
IVVKRKNVFALPTDMPIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCA
VALGAKSVTAIDISSEKLALAKSFGAMQTFNSSEMSAPQMQSVLRELRFNQLILETAGVP
QTVELAVEIAGPHAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQEWE
TASRLLTERKLSLEPLIAHRGSFESFAQAVRDIARNAMPGKVLLIP