Protein Info for OKFHMN_24120 in Escherichia coli ECRC101

Name: gatZ
Annotation: tagatose-bisphosphate aldolase subunit GatZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 PF08013: GatZ_KbaZ-like" amino acids 1 to 418 (418 residues), 638.4 bits, see alignment E=2.3e-196 TIGR02810: D-tagatose-bisphosphate aldolase, class II, non-catalytic subunit" amino acids 3 to 418 (416 residues), 701.5 bits, see alignment E=1.8e-215

Best Hits

Swiss-Prot: 100% identical to GATZ_ECO57: D-tagatose-1,6-bisphosphate aldolase subunit GatZ (gatZ) from Escherichia coli O157:H7

KEGG orthology group: K00917, tagatose 6-phosphate kinase [EC: 2.7.1.144] (inferred from 99% identity to eco:b2095)

MetaCyc: 99% identical to putative tagatose-1,6-bisphosphate aldolase 2 chaperone (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Tagatose-6-phosphate kinase GatZ (EC 2.7.1.144)" in subsystem D-Tagatose and Galactitol Utilization (EC 2.7.1.144)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.144

Use Curated BLAST to search for 2.7.1.144

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (420 amino acids)

>OKFHMN_24120 tagatose-bisphosphate aldolase subunit GatZ (Escherichia coli ECRC101)
MKTLIARHKAGEHIGICSVCSAHPLVIEAALAFDRNSTRKVLIEATSNQVNQFGGYTGMT
PADFREFVFAIADKVGFARERIILGGDHLGPNCWQQENVDAAMEKSVELVKAYVRAGFSK
IHLDASMSCAGDPIPLAPETVAERAAVLCFAAESVATDCQREQLSYVIGTEVPVPGGEAS
AIQSVHITHVEDAANTLRTHQKAFIARGLTEALTRVIAIVVQPGVEFDHSNIIHYQPQEA
QALAQWIENTRMVYEAHSTDYQTRTAYWELVRDHFAILKVGPALTFALREAIFALAQIEQ
ELIAPENRSGCLAVIEEVMLDEPQYWKKYYRTGFNDSLLDIRYSLSDRIRYYWPHSRIKN
SVETMMVNLQGVDIPLGMISQYLPKQFERIQSGELSAIPHQLIMDKIYDVLRAYRYGCAE