Protein Info for OKFHMN_24030 in Escherichia coli ECRC100

Name: yehB
Annotation: Outer membrane usher protein YehB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 826 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13954: PapC_N" amino acids 26 to 161 (136 residues), 117 bits, see alignment E=1.1e-37 PF00577: Usher" amino acids 177 to 743 (567 residues), 642.5 bits, see alignment E=1.1e-196 PF13953: PapC_C" amino acids 753 to 813 (61 residues), 36 bits, see alignment 7.7e-13

Best Hits

Swiss-Prot: 92% identical to YEHB_ECOLI: Outer membrane usher protein YehB (yehB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to etw:ECSP_2908)

Predicted SEED Role

"Fimbriae usher protein StcC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (826 amino acids)

>OKFHMN_24030 Outer membrane usher protein YehB (Escherichia coli ECRC100)
MLRMTPLASAIVALLLGIEAHAAEETFDTHFMMGGMKGEQVTNLRLDDNQPLPGQYDIDI
YVNKQWRGKYEIIVKDNPHETCLTREIVKRLGINSDNFARENQCLTFEQLVQGGSYSWDI
GIFRLDLAVPQAWVEELENGYVPPENWERGINAFYTSYYVSQYYSDYKASGNSKSTYVRF
NSGLNLLGWQLHSDASFSKTDNNPGEWKSNTLYLEHGFSQILGTLRIGDMYTSADIFDSV
RFTGVRLFRDMQMLPNSKQNFTPRVQGIAQSNALVTIEQNGFVVYQKEVPPGPFSISDLQ
LAGGGADLDVSVKEADGSVTTYLVPYAAVPNMLQPGVSKYDFAAGRSHIEGASKQSDFVQ
AGYQYGFNNLLTLYGGTMVANNYYAFTLGTGWNTRIGAISVDATKSHSKQDNGDVFDGQS
YQIAYNKFLSQTSTRFGLAAWRYSSRDYRTFNDYVWANNKDNYRRDKNDVYDIADYYQND
FGRKNSFSANMSQSLPEGWGSVSLSTLWRDYWGRSGSSKDYQLSYSNNWRRISYTLAASQ
AYDENHAEEKRFNIFISIPFDWGDDVTTPRRQIYMSNSTTFDDQGFASNNTGLSGTVGNR
DQFNYGINLSHQHQGNETTAGANLTWTAPAATVNGSYSQSSTYRQVGASVSGGLVAWSGG
VNLANRLSETFAVMHAPGIKDAYVNGQKYRTTNCNGVVVYDGLTPYRENHLMMDVSQSDS
ETELRGNRKMTAPYRGAVVLVDFDTDQRKPWFIKALRSDGQPLTFGYEVNDMHGHNIGVV
GQGSQIFIRTNEIPPAVNVAIDKQQGLSCTITFGKEIDESKNYICR