Protein Info for OKFHMN_23210 in Escherichia coli ECRC101

Name: ada
Annotation: bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 PF02805: Ada_Zn_binding" amino acids 11 to 75 (65 residues), 111.6 bits, see alignment E=3.6e-36 PF00165: HTH_AraC" amino acids 98 to 133 (36 residues), 43.6 bits, see alignment 5.7e-15 PF12833: HTH_18" amino acids 105 to 182 (78 residues), 59.1 bits, see alignment E=1.1e-19 PF02870: Methyltransf_1N" amino acids 189 to 266 (78 residues), 81.3 bits, see alignment E=1.9e-26 TIGR00589: methylated-DNA--[protein]-cysteine S-methyltransferase" amino acids 269 to 348 (80 residues), 126 bits, see alignment E=2.3e-41 PF01035: DNA_binding_1" amino acids 270 to 349 (80 residues), 120.1 bits, see alignment E=7.2e-39

Best Hits

Swiss-Prot: 99% identical to ADA_ECOLI: Bifunctional transcriptional activator/DNA repair enzyme Ada (ada) from Escherichia coli (strain K12)

KEGG orthology group: K10778, AraC family transcriptional regulator, regulatory protein of adaptative response / methylated-DNA-[protein]-cysteine methyltransferase [EC: 2.1.1.63] (inferred from 100% identity to ecs:ECs3102)

MetaCyc: 99% identical to DNA-binding transcriptional dual regulator / DNA repair protein Ada (Escherichia coli K-12 substr. MG1655)
2.1.1.M37 [EC: 2.1.1.M37]; Methylated-DNA--[protein]-cysteine S-methyltransferase. [EC: 2.1.1.M37, 2.1.1.63]; 2.1.1.63 [EC: 2.1.1.M37, 2.1.1.63]

Predicted SEED Role

"ADA regulatory protein / Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63)" in subsystem DNA repair, bacterial (EC 2.1.1.63)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.63

Use Curated BLAST to search for 2.1.1.63 or 2.1.1.M37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>OKFHMN_23210 bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada (Escherichia coli ECRC101)
MKNATCLTDDQRWQSVLARDPNADGEFVFAVRTTGIFCRPSCRARHALRENVSFYANASE
ALAAGFRPCKRCQPDKANAQQHRLDKITHACRLLEQETPVTLEALADQVAMSPFHLHRLF
KATTGMTPKAWQQAWRARRLRESLAKGESVTTSILNAGFPDSSSYYHKADETLGMTAKQF
RHGGENLAVRYALADCELGRCLVAESERGICAILLGDDDATLISELQQMFPAADNAPADL
TFQQHVREVIASLNQRDTPLTLPLDIRGTAFQQQVWQALRTIPCGETVSYQQLANAIGKP
KAVRAVASACAANKLAIVIPCHRVVRGDGTLSGYRWGVSRKAQLLRREAENEER