Protein Info for OKFHMN_23045 in Escherichia coli ECRC100

Name: yfaD
Annotation: ISNCY family transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 PF04754: Transposase_31" amino acids 8 to 209 (202 residues), 298.5 bits, see alignment E=1.2e-93 TIGR01784: conserved hypothetical protein" amino acids 9 to 304 (296 residues), 174.3 bits, see alignment E=2.3e-55

Best Hits

Swiss-Prot: 93% identical to RPNE_ECOLI: Inactive recombination-promoting nuclease-like protein RpnE (yfaD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to efe:EFER_0922)

MetaCyc: 65% identical to recombination-promoting nuclease RpnA (Escherichia coli K-12 substr. MG1655)
RXN0-7100

Predicted SEED Role

"Uncharacterized protein YfaD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>OKFHMN_23045 ISNCY family transposase (Escherichia coli ECRC100)
MTESTTSSPHDAVFKTFMFTPETARDFLEIHLPEPLRKLCNLQTLRLEPTSFIEKSLRAY
YSDVLWSVETSDGDGYIYCVIEHQSSAEKNMAFRLMRYATAAMQRHLDKGYDRVPLVVPL
LFYHGETSPYPYSLNWLDEFDDPQLARQLYTEAFPLVDITIVPDDEIMQHRRIALLELIQ
KHIRDRDLIGMVDRITTLLVRGFTNDSQLQTLFNYLLQCGDTSRFTRFIQEIAERSPLQK
ERLMTIAERLRQEGHQIGWQEGKLEGLQEGMHEQAIKIALRMLEQGFDRDLVLAATQLSE
ADLAANNH