Protein Info for OKFHMN_22845 in Escherichia coli ECRC101

Name: nuoB
Annotation: NADH-quinone oxidoreductase subunit NuoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01957: NADH-quinone oxidoreductase, B subunit
  • amino acids 37 to 178 (142 residues), 234.6 bits, E=1.8e-74
• PF01058: Oxidored_q6
  • amino acids 63 to 171 (109 residues), 93.9 bits, E=3.4e-31

Best Hits

Swiss-Prot: 100% identical to NUOB_SHIB3: NADH-quinone oxidoreductase subunit B (nuoB) from Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 100% identity to eco:b2287)

MetaCyc: 100% identical to NADH:quinone oxidoreductase subunit B (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• NADH to cytochrome bd oxidase electron transfer I (2/2 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NAD(P)/NADPH interconversion (4/6 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• aerobic respiration I (cytochrome c) (2/4 steps found)
• Fe(II) oxidation (1/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (220 amino acids)

>OKFHMN_22845 NADH-quinone oxidoreductase subunit NuoB (Escherichia coli ECRC101)
MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFG
LSCCYVEMVTSFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEP
KWVISMGACANSGGMYDIYSVVQGVDKFIPVDVYIPGCPPRPEAYMQALMLLQESIGKER
RPLSWVVGDQGVYRANMQSERERKRGERIAVTNLRTPDEI