Protein Info for OKFHMN_22430 in Escherichia coli ECRC101

Name: evgA
Annotation: acid-sensing system DNA-binding response regulator EvgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 PF00072: Response_reg" amino acids 4 to 114 (111 residues), 95.8 bits, see alignment E=1.9e-31 PF00196: GerE" amino acids 142 to 198 (57 residues), 76.6 bits, see alignment E=9.1e-26

Best Hits

Swiss-Prot: 100% identical to EVGA_ECOLI: DNA-binding transcriptional activator EvgA (evgA) from Escherichia coli (strain K12)

KEGG orthology group: K07690, two-component system, NarL family, response regulator EvgA (inferred from 100% identity to eco:b2369)

Predicted SEED Role

"Positive transcription regulator EvgA" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>OKFHMN_22430 acid-sensing system DNA-binding response regulator EvgA (Escherichia coli ECRC101)
MNAIIIDDHPLAIAAIRNLLIKNDIEILAELTEGGSAVQRVETLKPDIVIIDVDIPGVNG
IQVLETLRKRQYSGIIIIVSAKNDHFYGKHCADAGANGFVSKKEGMNNIIAAIEAAKNGY
CYFPFSLNRFVGSLTSDQQKLDSLSKQEISVMRYILDGKDNNDIAEKMFISNKTVSTYKS
RLMEKLECKSLMDLYTFAQRNKIG