Protein Info for OKFHMN_21980 in Escherichia coli ECRC101

Name: aegA
Annotation: formate-dependent uric acid utilization protein AegA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13247: Fer4_11
  • amino acids 55 to 144 (90 residues), 38.2 bits, E=9.5e-13
• PF12837: Fer4_6
  • amino acids 80 to 100 (21 residues), 27.7 bits, see alignment (E = 1.3e-09)
• PF00037: Fer4
  • amino acids 80 to 100 (21 residues), 28.1 bits, see alignment (E = 9e-10)
• PF12797: Fer4_2
  • amino acids 82 to 99 (18 residues), 25 bits, see alignment (E = 8.8e-09)
• TIGR01318: glutamate synthase, small subunit
  • amino acids 187 to 653 (467 residues), 876.9 bits, E=1.4e-268
• PF14691: Fer4_20
  • amino acids 205 to 315 (111 residues), 125.4 bits, E=6.9e-40
• PF01494: FAD_binding_3
  • amino acids 329 to 360 (32 residues), 25 bits, see alignment (E = 7.5e-09)
• PF07992: Pyr_redox_2
  • amino acids 329 to 640 (312 residues), 83.6 bits, E=1.2e-26
• PF13450: NAD_binding_8
  • amino acids 332 to 366 (35 residues), 32.4 bits, see alignment (E = 6.5e-11)
• PF00070: Pyr_redox
  • amino acids 470 to 544 (75 residues), 22.3 bits, E=1.1e-07

Best Hits

Swiss-Prot: 99% identical to AEGA_ECOLI: Protein AegA (aegA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ece:Z3724)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (1/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (1/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Protein Sequence (659 amino acids)

>OKFHMN_21980 formate-dependent uric acid utilization protein AegA (Escherichia coli ECRC101)
MNRFIMANSQQCLGCHACEIACVMAHNDEQHVLSQHHFHPRITVIKHQQQRSAVTCHHCE
DAPCARSCPNGAISHVDDSIQVNQQKCIGCKSCVVACPFGTMQIVLTPVAAGKVKATAHK
CDLCAGRENGPACVENCPADALQLVTDAALSGMAKSRRLRTARQEHQPWHASTAAQEMPV
MSKVEQMQATPARGEPDKLAIEARKTGFDEIYLPFRADQAQREASRCLKCGEHSVCEWTC
PLHNHIPQWIELVKAGNIDAAVELSHLTNTLPEITGRVCPQDRLCEGACTIRDEHGAVTI
GNIERYISDQALAKGWRPDLSHVTKVDKRVAIIGAGPAGLACADVLIRNGVAVTVYDRHP
EIGGLLTFGIPSFKLDKSLLARRREIFSAMGIHFELNCEVGKDVSLDSLLEQYDAVFVGV
GTYRSMKAGLPNEDAPGVYDALPFLIANTKQVMGLEELPEEPFINTAGLNVVVLGGGDTA
MDCVRTALRHGASNVTCAYRRDEANMPGSKKEVKNAREEGANFEFNVQPVALELNEQGHV
CGIRFLRTRLGEPDAQGRRRPVPVEGSEFVMPADAVIMAFGFNPHGMPWLESHGVTVDKW
GRIIADVESQYRYQTTNPKIFAGGDAVRGADLVVTAMAEGRHAAQGIIDWLGVKSVKSH