Protein Info for OKFHMN_21880 in Escherichia coli ECRC100

Name: hyfE
Annotation: hydrogenase 4 membrane subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 54 (24 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 126 to 143 (18 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details PF00420: Oxidored_q2" amino acids 128 to 216 (89 residues), 64.5 bits, see alignment E=3.1e-22

Best Hits

Swiss-Prot: 100% identical to HYFE_SHIFL: Hydrogenase-4 component E (hyfE) from Shigella flexneri

KEGG orthology group: K12140, hydrogenase-4 component E [EC: 1.-.-.-] (inferred from 100% identity to eco:b2485)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (216 amino acids)

>OKFHMN_21880 hydrogenase 4 membrane subunit (Escherichia coli ECRC100)
MTGSMIVNNLAGLMMLTSLFVISVKSYRLSCGFYACQSLVLVSIFATLSCLFAAEQLLIW
SASAFITKVLLVPLIMTYAARNIPQNIPEKALFGPAMMALLAALIVLLCAFVVQPVKLPM
ATGLKPALAVALGHFLLGLLCIVSQRNILRQIFGYCLMENGSHLVLALLAWRAPELVEIG
IATDAIFAVIVMVLLARKIWRTHGTLDVNNLTALKG