Protein Info for OKFHMN_21865 in Escherichia coli ECRC101

Name: hyfH
Annotation: hydrogenase 4 subunit H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 PF00037: Fer4" amino acids 36 to 56 (21 residues), 27 bits, see alignment (E = 5.6e-10) amino acids 73 to 91 (19 residues), 33 bits, see alignment (E = 7.2e-12) PF12838: Fer4_7" amino acids 39 to 89 (51 residues), 44.8 bits, see alignment E=2.8e-15 PF13187: Fer4_9" amino acids 39 to 90 (52 residues), 32.9 bits, see alignment E=1e-11

Best Hits

Swiss-Prot: 98% identical to HYFH_ECOLI: Hydrogenase-4 component H (hyfH) from Escherichia coli (strain K12)

KEGG orthology group: K12143, hydrogenase-4 component H (inferred from 98% identity to eco:b2488)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (181 amino acids)

>OKFHMN_21865 hydrogenase 4 subunit H (Escherichia coli ECRC101)
MLKLLKTIMRAGTATVKYPFAPLEVSPGFRGKPDLMPSQCIACGACACACPTNALTIQTD
DQQNSRTWQLYLGRCIYCGRCEEVCPTRAIQLTNNFELTVTNKADLYTRATFHLQRCSRC
ERPFAPQKTVALAAELLAQQQNAPQNREMLRAQASVCPECKQRATLINDDTDVPLVAKEQ
L