Protein Info for OKFHMN_21845 in Escherichia coli ECRC100

Name: focB
Annotation: formate transporter FocB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 34 to 55 (22 residues), see Phobius details amino acids 68 to 90 (23 residues), see Phobius details amino acids 109 to 134 (26 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 194 to 222 (29 residues), see Phobius details amino acids 254 to 276 (23 residues), see Phobius details PF01226: Form_Nir_trans" amino acids 20 to 273 (254 residues), 215.4 bits, see alignment E=3.9e-68 TIGR00790: formate/nitrite transporter" amino acids 26 to 279 (254 residues), 287.6 bits, see alignment E=3.9e-90

Best Hits

Swiss-Prot: 99% identical to FOCB_ECOLI: Probable formate transporter 2 (focB) from Escherichia coli (strain K12)

KEGG orthology group: K03459, formate transporter (inferred from 99% identity to eco:b2492)

MetaCyc: 99% identical to formate channel FocB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-1

Predicted SEED Role

"Formate efflux transporter (TC 2.A.44 family)" in subsystem Fermentations: Mixed acid

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (282 amino acids)

>OKFHMN_21845 formate transporter FocB (Escherichia coli ECRC100)
MRNKLSFDLQLSARKAAIAERIAAHKIARSKVSVFLMAMSAGVFMAIGFTFYLSVIADAP
SSQALTHLVGGLCFTLGFILLAVCGTSLFTSSVMTVMAKSRGVISWRTWLINALLVACGN
LAGIACFSLLIWFSGLVMSENAMWGVAVLHCAEGKMHHTFTESVSLGIMCNLMVCLALWM
SYCGRSLCDKIVAMILPITLFVASGFEHCIANLFVIPFAIAIRHFAPTSFWQLAHSSADN
FPALTVSHFITANLLPVMLGNIIGGAVLVSICYRAIYLRQES