Protein Info for OKFHMN_20405 in Escherichia coli ECRC100

Name: casB
Annotation: type I-E CRISPR-associated protein Cse2/CasB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 TIGR02548: CRISPR type I-E/ECOLI-associated protein CasB/Cse2" amino acids 12 to 169 (158 residues), 127.7 bits, see alignment E=2.6e-41 PF09485: CRISPR_Cse2" amino acids 25 to 167 (143 residues), 68.5 bits, see alignment E=4.4e-23

Best Hits

KEGG orthology group: None (inferred from 99% identity to eok:G2583_3407)

Predicted SEED Role

"CRISPR-associated protein, Cse2 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (178 amino acids)

>OKFHMN_20405 type I-E CRISPR-associated protein Cse2/CasB (Escherichia coli ECRC100)
MSIVKEEHKATLRKWHEELQEKRGERASLRRSTTVNDVCLTDGFRLFLKNRQIKWQDEPE
WRITALALIAALSANVKAIDERLPFAAQLAAVMSKGRFTRLSAVKTPDELLRQLRRVVRL
LNGSVNLDSLAEGVFRWCQESDDLLNHHRRHQRPTEFIRIRWALEYYQAGDVDNEQNQ