Protein Info for OKFHMN_20380 in Escherichia coli ECRC101

Name: cysH
Annotation: phosphoadenosine phosphosulfate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 TIGR02057: phosphoadenosine phosphosulfate reductase" amino acids 21 to 242 (222 residues), 345.3 bits, see alignment E=1.9e-107 TIGR00434: phosophoadenylyl-sulfate reductase" amino acids 33 to 243 (211 residues), 318.7 bits, see alignment E=2.2e-99 PF01507: PAPS_reduct" amino acids 48 to 219 (172 residues), 198.8 bits, see alignment E=3.8e-63

Best Hits

Swiss-Prot: 100% identical to CYSH_ECO5E: Phosphoadenosine phosphosulfate reductase (cysH) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K00390, phosphoadenosine phosphosulfate reductase [EC: 1.8.4.8] (inferred from 99% identity to eco:b2762)

MetaCyc: 99% identical to phosphoadenosine phosphosulfate reductase (Escherichia coli K-12 substr. MG1655)
Phosphoadenylyl-sulfate reductase (thioredoxin). [EC: 1.8.4.8]

Predicted SEED Role

"Phosphoadenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.8)" in subsystem Cysteine Biosynthesis (EC 1.8.4.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (244 amino acids)

>OKFHMN_20380 phosphoadenosine phosphosulfate reductase (Escherichia coli ECRC101)
MSKLDLNALNELPKVDRILALAETNAQLEKLDAEGRVAWALDNLPGEYVLSSSFGIQAAV
SLHLVNQIRPDIPVILTDTGYLFPETYRFIDELTDKLKLNLKVYRATESAAWQEARYGKL
WEQGVEGIEKYNDINKVEPMNRALKELNAQTWFAGLRREQSGSRANLPVLAIQRGVFKVL
PIIDWDNRTIYQYLQKNGLKYHPLWDEGYLSVGDTHTTRKWEPGMAEEETRFFGLKRECG
LHEG