Protein Info for OKFHMN_20230 in Escherichia coli ECRC101

Name: gudD
Annotation: glucarate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02746: MR_MLE_N
  • amino acids 27 to 55 (29 residues), 24 bits, see alignment (E = 3.8e-09)
• PF13378: MR_MLE_C
  • amino acids 106 to 323 (218 residues), 171.2 bits, E=2.7e-54

Best Hits

Swiss-Prot: 100% identical to GUDX_ECOLI: Glucarate dehydratase-related protein (gudX) from Escherichia coli (strain K12)

KEGG orthology group: K13918, glucarate dehydratase-related protein (inferred from 100% identity to eco:b2788)

MetaCyc: 65% identical to D-glucarate dehydratase subunit (Acinetobacter baylyi ADP1)
Glucarate dehydratase. [EC: 4.2.1.40]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of D-glucarate and D-galactarate degradation (5/5 steps found)
• D-glucarate degradation I (4/4 steps found)
• D-glucarate degradation II (1/3 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (19/31 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.40

Use Curated BLAST to search for 4.2.1.40

Protein Sequence (365 amino acids)

>OKFHMN_20230 glucarate dehydratase (Escherichia coli ECRC101)
VVQQVHKGNQAADFDTFGKGAWTFELRVNAVAALEAALLDLLGKALNVPVCELLGPGKQR
DAITVLGYLFYIGDRTKTDLPYLENTPGNHEWYQLRHQKAMNSEAVVRLAEASQDRYGFK
DFKLKGGVLPGEQEIDTVRALKKRFPDARITVDPNGAWLLDEAISLCKGLNDVLTYAEDP
CGAEQGFSGREVMAEFRRATGLPVATNMIATNWREMGHAVMLNAVDIPLADPHFWTLSGA
VRVAQLCDDWGLTWGCHSNNHFDISLAMFTHVGAAAPGNPTAIDTHWIWQEGDCRLTQNP
LEIKNGKIAVPDAPGLGVELDWEQVQKAHEAYKRLPGGARNDAGPMQYLIPGWTFDRKRP
VFGRH