Protein Info for OKFHMN_20190 in Escherichia coli ECRC101

Name: queF
Annotation: NADPH-dependent 7-cyano-7-deazaguanine reductase QueF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 TIGR03138: queuine synthase" amino acids 11 to 282 (272 residues), 435 bits, see alignment E=6.3e-135 PF14819: QueF_N" amino acids 21 to 131 (111 residues), 165.1 bits, see alignment E=6.5e-53 PF14489: QueF" amino acids 196 to 270 (75 residues), 87.2 bits, see alignment E=7e-29

Best Hits

Swiss-Prot: 100% identical to QUEF_ECO5E: NADPH-dependent 7-cyano-7-deazaguanine reductase (queF) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K06879, 7-cyano-7-deazaguanine reductase [EC: 1.7.1.13] (inferred from 99% identity to eoj:ECO26_3864)

MetaCyc: 98% identical to 7-cyano-7-deazaguanine reductase (Escherichia coli K-12 substr. MG1655)
PreQ(1) synthase. [EC: 1.7.1.13]

Predicted SEED Role

"NADPH dependent preQ0 reductase (EC 1.7.1.13)" (EC 1.7.1.13)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (282 amino acids)

>OKFHMN_20190 NADPH-dependent 7-cyano-7-deazaguanine reductase QueF (Escherichia coli ECRC101)
MSSYANHQALAGLTLGKSTDYRDTYDASLLQGVPRSLNRDPLGLKADNLPFQGTDIWTLY
ELSWLNAKGLPQVAVGHVELDYTSVNLIESKSFKLYLNSFNQTRFNNWDEVRQTLERDLS
TCAQGEVSVALYRLDELEGQPIGHFNGTCIDDQDITIDNYEFTTDYLENATSGEKVVEET
LVSHLLKSNCLITHQPDWGSIQIQYRGRQIDREKLLRYLVSFRHHNEFHEQCVERIFNDL
LRFCQPEKLSVYARYTRRGGLDINPWRSNSDFVPSTTRLVRQ