Protein Info for OKFHMN_20105 in Escherichia coli ECRC101
Name: csdA
Annotation: cysteine desulfurase CsdA
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 99% identical to CSDA_ECOLI: Cysteine desulfurase CsdA (csdA) from Escherichia coli (strain K12)
KEGG orthology group: K01766, cysteine sulfinate desulfinase [EC: 4.4.1.-] (inferred from 99% identity to eco:b2810)MetaCyc: 99% identical to cysteine sulfinate desulfinase (Escherichia coli K-12 substr. MG1655)
2.8.7.M1 [EC: 2.8.7.M1]
Predicted SEED Role
"Cysteine desulfurase CsdA-CsdE (EC 2.8.1.7), main protein CsdA" in subsystem Alanine biosynthesis (EC 2.8.1.7)
MetaCyc Pathways
- superpathway of thiamine diphosphate biosynthesis I (10/10 steps found)
- molybdopterin biosynthesis (6/6 steps found)
- thiazole component of thiamine diphosphate biosynthesis I (6/6 steps found)
- superpathway of L-alanine biosynthesis (4/4 steps found)
- superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
- L-alanine biosynthesis III (1/1 steps found)
- L-cysteine degradation IV (1/1 steps found)
- thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
- cytidylyl molybdenum cofactor sulfurylation (1/2 steps found)
- tRNA-uridine 2-thiolation and selenation (bacteria) (7/11 steps found)
- bis(guanylyl molybdopterin) cofactor sulfurylation (1/3 steps found)
- tRNA-uridine 2-thiolation (mammalian mitochondria) (1/4 steps found)
- tRNA-uridine 2-thiolation (yeast mitochondria) (1/4 steps found)
- tRNA-uridine 2-thiolation (thermophilic bacteria) (1/5 steps found)
- [2Fe-2S] iron-sulfur cluster biosynthesis (4/10 steps found)
- tRNA-uridine 2-thiolation (cytoplasmic) (1/8 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.8.1.7
Use Curated BLAST to search for 2.8.1.7 or 2.8.7.M1 or 4.4.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (401 amino acids)
>OKFHMN_20105 cysteine desulfurase CsdA (Escherichia coli ECRC101) MNVFNPAQFRAQFPALQDAGVYLDSAATALKPEAVVEATRQFYSLSAGNVHRSQFAEAQR LTARYEAAREKVAQLLNAPDDKTIVWTRGTTESINMVAQCYARPRLQPGDEIIVSVAEHH ANLVPWLMVAQQTGAKVVKLPLNAQRLPDVDLLPELITPRSRILALGQMSNVTGGCPDLA RAITFAHSAGIVVIVDGAQGAVHFPADVQQLDIDFYAFSGHKLYGPTGIGVLYGKSELLE AMSPWLGGGKMVHEVSFDGFTTQSAPWKLEAGTPNVAGVIGLSAALEWLADYDINQAENW SRSLATLAEDALAKRPGFRSFRCQDSSLLAFDFAGVHHSDMVTLLAEYGIALRAGQHCAQ PLLAELGVTGTLRASFAPYNTKSDVDALVNAVDRALELLVD