Protein Info for OKFHMN_19830 in Escherichia coli ECRC101

Name: escJ
Annotation: EscJ/YscJ/HrcJ family type III secretion inner membrane ring protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 210 to 229 (20 residues), see Phobius details TIGR02544: type III secretion apparatus lipoprotein, YscJ/HrcJ family" amino acids 3 to 190 (188 residues), 218.2 bits, see alignment E=4.2e-69 PF01514: YscJ_FliF" amino acids 18 to 186 (169 residues), 47.4 bits, see alignment E=1e-16

Best Hits

Swiss-Prot: 58% identical to PRGK_SALTY: Lipoprotein PrgK (prgK) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03222, type III secretion protein SctJ (inferred from 100% identity to ecs:ECs3716)

Predicted SEED Role

"Type III secretion bridge between inner and outermembrane lipoprotein (YscJ,HrcJ,EscJ, PscJ)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (244 amino acids)

>OKFHMN_19830 EscJ/YscJ/HrcJ family type III secretion inner membrane ring protein (Escherichia coli ECRC101)
MKYISLLLFILLLCGCKQQELLNHLDQQQANDVLAVLQRHNINAEKKDQGKTGFSIYVEP
TDFASAVDWLKIYNLPGKPDIQISQMFPADALVSSPRAEKARLYSAIEQRLEQSLKIMDG
IVSSRVHVSYDVDTGDSGKTALPIHISVLAVYEKDINPEIKINDIKRFIVNSFASVQYEN
ISVVLSKRRDIIEQAPTYEISEPVFAYDKAMPVSILLALISVATCWLLWKYRAILTNLVR
LKIK