Protein Info for OKFHMN_19705 in Escherichia coli ECRC101

Name: xdhB
Annotation: xanthine dehydrogenase FAD-binding subunit XdhB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00941: FAD_binding_5
  • amino acids 6 to 173 (168 residues), 173.9 bits, E=2.6e-55
• PF03450: CO_deh_flav_C
  • amino acids 183 to 283 (101 residues), 98.9 bits, E=1.7e-32

Best Hits

Swiss-Prot: 100% identical to XDHB_ECO57: Xanthine dehydrogenase FAD-binding subunit (xdhB) from Escherichia coli O157:H7

KEGG orthology group: K13479, xanthine dehydrogenase FAD-binding subunit [EC: 1.17.1.4] (inferred from 99% identity to eco:b2867)

MetaCyc: 99% identical to putative xanthine dehydrogenase FAD-binding subunit XdhB (Escherichia coli K-12 substr. MG1655)
Xanthine dehydrogenase. [EC: 1.17.1.4]; 1.17.1.4 [EC: 1.17.1.4]

Predicted SEED Role

"Xanthine dehydrogenase, FAD binding subunit (EC 1.17.1.4)" in subsystem Purine Utilization (EC 1.17.1.4)

MetaCyc Pathways

• purine nucleotides degradation II (aerobic) (11/11 steps found)
• adenosine nucleotides degradation II (5/5 steps found)
• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• guanosine nucleotides degradation II (4/4 steps found)
• guanosine nucleotides degradation III (4/4 steps found)
• inosine 5'-phosphate degradation (4/4 steps found)
• superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
• guanosine nucleotides degradation I (3/4 steps found)
• superpathway of purines degradation in plants (13/18 steps found)
• ureide biosynthesis (5/7 steps found)
• purine nucleobases degradation II (anaerobic) (17/24 steps found)
• caffeine degradation III (bacteria, via demethylation) (1/7 steps found)
• theophylline degradation (1/9 steps found)
• caffeine degradation IV (bacteria, via demethylation and oxidation) (1/10 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4

Use Curated BLAST to search for 1.17.1.4

Protein Sequence (292 amino acids)

>OKFHMN_19705 xanthine dehydrogenase FAD-binding subunit XdhB (Escherichia coli ECRC101)
MFDFASYHRAATLADAINLLADNPQAKLLAGGTDVLIQLHHHNDRYRHIVDIHNLAELRG
ITLAEDGSLRIGSATTFTQLIEDSITQRHLPALCAAASSIAGPQIRNVATYGGNICNGAT
SADSATPTLIYDAKLEIHSPRGVRFVPINGFHTGPGKVSLEHDEILVAFHFPPQPKEHVG
SAHFKYAMRDAMDISTIGCAAHCRLDNGNFSELRLAFGVAAPTPIRCQHAEQTAQNAPLN
LQTLEAISESVLQDVAPRSSWRASKEFRLHLIQTMTKKVISEAVAAAGGKLQ