Protein Info for OKFHMN_19665 in Escherichia coli ECRC100

Name: yqeB
Annotation: selenium-dependent molybdenum cofactor biosynthesis protein YqeB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 541 PF02625: XdhC_CoxI" amino acids 12 to 74 (63 residues), 69.7 bits, see alignment E=2.4e-23 PF13478: XdhC_C" amino acids 106 to 247 (142 residues), 113.6 bits, see alignment E=1.4e-36 TIGR03309: selenium-dependent molybdenum hydroxylase system protein, YqeB family" amino acids 271 to 526 (256 residues), 417.1 bits, see alignment E=1.3e-129

Best Hits

Swiss-Prot: 99% identical to YQEB_ECOLI: Uncharacterized protein YqeB (yqeB) from Escherichia coli (strain K12)

KEGG orthology group: K07402, xanthine dehydrogenase accessory factor (inferred from 100% identity to ece:Z4214)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (541 amino acids)

>OKFHMN_19665 selenium-dependent molybdenum cofactor biosynthesis protein YqeB (Escherichia coli ECRC100)
MNIFTEAAKLEEQNCPFAMAQIIDSRGSTPRHSAQMLVRADGSIVGTIGGGMVERKVIEE
SLQALQERKPRLFHGRMARNGADAVGSDCGGAMSVFISVHGMRPRLVLIGAGHVNRAIAQ
SAALLGFDIAVADIYRESLNPELFPPSTTLLHAESFGAAVEALDIRPANFVLIATNNQDR
EALDKLIEQPIAWLGLLASRRKVQLFLRQLREKGVAEEHIARLHAPVGYNIGAETPQEIA
ISVLAEILQVKNNAPGGLMMKPSHPSGHQLVVIRGAGDIASGVALRLYHAGFKVIMLEVE
KPTVIRCTVAFAQAVFDGEMTVEGVTARLATSSAEAMKLTERGFIPVMVDPACSLLDELK
PLCVVDAILAKQNLGTRADMAPVTIALGPGFAAGKDCHAVIETNRGHWLGQVIYCGCAQE
NTGVPGNIMGHTTRRVIRAPAAGIMRSNVKLGDLVKEGDVIAWIGEHEIKAPLTGMVRGL
LNDGLAVVGGFKIGDIDPRGETADFTSVSDKARAIGGGVLEALMMLMHQGVKATKEVLEV
A