Protein Info for OKFHMN_19410 in Escherichia coli ECRC100

Name: argO
Annotation: arginine exporter ArgO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 37 to 61 (25 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 182 to 199 (18 residues), see Phobius details PF01810: LysE" amino acids 14 to 201 (188 residues), 186.1 bits, see alignment E=2.5e-59 TIGR00948: L-lysine exporter" amino acids 15 to 191 (177 residues), 240.3 bits, see alignment E=5.4e-76

Best Hits

Swiss-Prot: 100% identical to ARGO_ECO57: Arginine exporter protein ArgO (argO) from Escherichia coli O157:H7

KEGG orthology group: K06895, L-lysine exporter family protein LysE/ArgO (inferred from 98% identity to eco:b2923)

MetaCyc: 98% identical to L-arginine exporter (Escherichia coli K-12 substr. MG1655)
RXN66-448; TRANS-RXN-325

Predicted SEED Role

"Arginine exporter protein ArgO"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>OKFHMN_19410 arginine exporter ArgO (Escherichia coli ECRC100)
VFSYYFQGLALGAAMILPLGPQNAFVMNQGIRRQYHIMIALLCAISDLVLICAGIFGGSA
LLMQSPWLLALVTWGGVVFLLWYGFGAFKTAMSSNIELASAEVLKQGRWKIIATMLAVTW
LNPHVYLDTFVVLGSLGGQLDVEPKRWFALGTISASFLWFFGLAILAAWLAPRLRTAKSQ
RIINLVVGCVMWFIALQLARDGIAHAQALFS