Protein Info for OKFHMN_19030 in Escherichia coli ECRC100

Name: hybE
Annotation: hydrogenase-2 assembly chaperone

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF11939: NiFe-hyd_HybE" amino acids 12 to 155 (144 residues), 159.3 bits, see alignment E=3.5e-51 TIGR03993: [NiFe] hydrogenase assembly chaperone, HybE family" amino acids 16 to 153 (138 residues), 157.3 bits, see alignment E=1.2e-50

Best Hits

Swiss-Prot: 100% identical to HYBE_ECO57: Hydrogenase-2 operon protein HybE (hybE) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 99% identity to eco:b2992)

Predicted SEED Role

"Hydrogenase-2 operon protein hybE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>OKFHMN_19030 hydrogenase-2 assembly chaperone (Escherichia coli ECRC100)
MTEEIAGFQTSPKAQVQAAFEEIARRSMHALSFLHPSMPVYVSDFTLFEGQWTGCVITPW
MLSAVIFPGPDQLWPLRKVSEKIGLQLPYGTMTFTVGELDGVSQYLSCSLMSPLSHSMSI
EEGQRLTDDCARMILSLPVTNPDVPHAGRRALLFGRRSGENA