Protein Info for OKFHMN_19025 in Escherichia coli ECRC100

Name: hybD
Annotation: HyaD/HybD family hydrogenase maturation endopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00140: hydrogenase expression/formation protein
  • amino acids 3 to 153 (151 residues), 184.9 bits, E=8.5e-59
• TIGR00072: hydrogenase maturation protease
  • amino acids 4 to 148 (145 residues), 154.1 bits, E=2.4e-49
• PF01750: HycI
  • amino acids 20 to 147 (128 residues), 130.6 bits, E=1.6e-42

Best Hits

Swiss-Prot: 99% identical to HYBD_ECOLI: Hydrogenase 2 maturation protease (hybD) from Escherichia coli (strain K12)

KEGG orthology group: K08567, hydrogenase 2 maturation protease [EC: 3.4.24.-] (inferred from 99% identity to eco:b2993)

MetaCyc: 99% identical to hydrogenase 2 maturation protease (Escherichia coli K-12 substr. MG1655)
RXN-22655 [EC: 3.4.23.51]

Predicted SEED Role

"Hydrogenase maturation protease (EC 3.4.24.-)" in subsystem Membrane-bound Ni, Fe-hydrogenase (EC 3.4.24.-)

MetaCyc Pathways

• NiFe(CO)(CN)₂ cofactor biosynthesis (9/10 steps found)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.23.51 or 3.4.24.-

Protein Sequence (164 amino acids)

>OKFHMN_19025 HyaD/HybD family hydrogenase maturation endopeptidase (Escherichia coli ECRC100)
MRILVLGVGNILLTDEAIGVRIVEALEQRYILPDYVEILDGGTAGMELLGDMANRDHLII
ADAIVSKKSAPGTMMILRDEEVPALFTNKISPHQLGLADVLSALRFTGEFPKKLTLVGVI
PESLEPHIGLTPTVEAMIEPALEQVLAALRESGVEAIPREAIHD