Protein Info for OKFHMN_18570 in Escherichia coli ECRC100

Name: higA
Annotation: type II toxin-antitoxin system antitoxin HigA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 PF01381: HTH_3" amino acids 84 to 135 (52 residues), 31 bits, see alignment E=1e-11

Best Hits

Swiss-Prot: 99% identical to HIGA_ECOL6: Antitoxin HigA (higA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to ecf:ECH74115_4396)

MetaCyc: 99% identical to antitoxin/DNA-binding transcriptional repressor HigA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"FIG074102: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (138 amino acids)

>OKFHMN_18570 type II toxin-antitoxin system antitoxin HigA (Escherichia coli ECRC100)
MIAIADILHAGEKLTAVAPFLAGIQNEEQYIQALELVDHLLLNDPENPLLDLVCAKITAW
EESAPEFAEFNAMAQAMPGGIAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLE
HAKKLATRFGISPALFID