Protein Info for OKFHMN_17790 in Escherichia coli ECRC101

Name: argR
Annotation: transcriptional regulator ArgR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF01316: Arg_repressor" amino acids 6 to 74 (69 residues), 89.7 bits, see alignment E=8.5e-30 TIGR01529: arginine repressor" amino acids 9 to 152 (144 residues), 164.7 bits, see alignment E=7.2e-53 PF02863: Arg_repressor_C" amino acids 82 to 148 (67 residues), 77 bits, see alignment E=8e-26

Best Hits

Swiss-Prot: 100% identical to ARGR_SHIFL: Arginine repressor (argR) from Shigella flexneri

KEGG orthology group: K03402, transcriptional regulator of arginine metabolism (inferred from 100% identity to eco:b3237)

Predicted SEED Role

"Arginine pathway regulatory protein ArgR, repressor of arg regulon" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (156 amino acids)

>OKFHMN_17790 transcriptional regulator ArgR (Escherichia coli ECRC101)
MRSSAKQEELVKAFKALLKEEKFSSQGEIVAALQEQGFDNINQSKVSRMLTKFGAVRTRN
AKMEMVYCLPAELGVPTTSSPLKNLVLDIDYNDAVVVIHTSPGAAQLIARLLDSLGKAEG
ILGTIAGDDTIFTTPANGFTVKDLYEAILELFDQEL