Protein Info for OKFHMN_17090 in Escherichia coli ECRC100

Name: hofN
Annotation: Putative DNA utilization protein HofN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details PF05137: PilN" amino acids 99 to 166 (68 residues), 37 bits, see alignment E=1.4e-13

Best Hits

Swiss-Prot: 97% identical to HOFN_SHIFL: Putative DNA utilization protein HofN (hofN) from Shigella flexneri

KEGG orthology group: K12289, pilus assembly protein HofN (inferred from 99% identity to eoh:ECO103_4112)

Predicted SEED Role

"Type IV pilus biogenesis protein PilN" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (179 amino acids)

>OKFHMN_17090 Putative DNA utilization protein HofN (Escherichia coli ECRC100)
MNPPINFLPWRQQRRTAFLRFWLLMFVAPLLLAVGITLILRLTSSAEARVDAVLLQGEQQ
LARSLQITKPRLLERQQIREQRLQRQRQRQFTRDWQSALEALAALLPEHAWLTTISWQQG
TLEIKGLTTSITALNALETSLRQDASFHLNQRGATQQDAQGRWQFEYQLTRKVSDEHVL