Protein Info for OKFHMN_16945 in Escherichia coli ECRC100

Name: rtcR
Annotation: DNA-binding transcriptional regulator RtcR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 532 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF06956: RtcR" amino acids 2 to 185 (184 residues), 283.9 bits, see alignment E=1.3e-88 PF00158: Sigma54_activat" amino acids 187 to 355 (169 residues), 171.5 bits, see alignment E=4e-54 PF14532: Sigma54_activ_2" amino acids 193 to 361 (169 residues), 55.7 bits, see alignment E=2e-18 PF01078: Mg_chelatase" amino acids 202 to 311 (110 residues), 22.1 bits, see alignment E=2.8e-08 PF00004: AAA" amino acids 211 to 310 (100 residues), 28.3 bits, see alignment E=6.7e-10 PF07728: AAA_5" amino acids 211 to 329 (119 residues), 29.8 bits, see alignment E=1.7e-10

Best Hits

Swiss-Prot: 99% identical to RTCR_ECOLI: Transcriptional regulatory protein RtcR (rtcR) from Escherichia coli (strain K12)

KEGG orthology group: K14414, transcriptional regulatory protein RtcR (inferred from 100% identity to etw:ECSP_4374)

Predicted SEED Role

"Transcriptional regulatory protein RtcR" in subsystem RNA 3'-terminal phosphate cyclase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (532 amino acids)

>OKFHMN_16945 DNA-binding transcriptional regulator RtcR (Escherichia coli ECRC100)
MRKTVAFGFVGTVLDYAGRGSQRWSKWRPSLCICQQESLVIDRLELLHDARSRSLFETLK
RDIASVSPETEVVSVEIELHNPWDFEEVYACLHDFARGYEFQPEKEDYLIHITTGTHVAQ
ICWFLLAEARYLPARLIQSSPPRKKEQPRGAGEVTIIDLDLSLYNAIASRFAEERQQTLD
FLKSGIATRNPHFNRMIEQIEKVAIKSRAPILLNGPTGAGKSFLARRIFELKQARHQFSG
AFVEVNCATLRGDTAMSTLFGHVKGAFTGARESREGLLRSANGGMLFLDEIGELGADEQA
MLLKAIEEKTFYPFGSDRQVSSDFQLIAGTVRDLRQLVADGKFREDLYARINLWTFTLPG
LRQRQEDIEPNLDYEVERHASLTGDSVRFNTEARRAWLAFATSPQATWRGNFRELSASVT
RMATFASSGRITLDVVEDEINRLRYNWQESRPSALTALLGAEAENIDLFDRMQLEHVIAI
CRQAKSLSAAGRQLFDVSRQGKASVNDADRLRKYLARFGLTWEAVQDQHSSS