Protein Info for OKFHMN_16530 in Escherichia coli ECRC100

Name: nikE
Annotation: nickel import ATP-binding protein NikE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02769: nickel import ATP-binding protein NikE
  • amino acids 2 to 265 (264 residues), 447.4 bits, E=8.8e-139
• PF00005: ABC_tran
  • amino acids 28 to 179 (152 residues), 140.1 bits, E=3.9e-45

Best Hits

Swiss-Prot: 100% identical to NIKE_ECO57: Nickel import ATP-binding protein NikE (nikE) from Escherichia coli O157:H7

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to eok:G2583_4201)

MetaCyc: 96% identical to nickel ABC transporter ATP binding subunit NikE (Escherichia coli K-12 substr. MG1655)
7.2.2.i [EC: 7.2.2.i]; 7.2.2.- [EC: 7.2.2.i]

Predicted SEED Role

"Nickel transport ATP-binding protein NikE (TC 3.A.1.5.3)" in subsystem Transport of Nickel and Cobalt (TC 3.A.1.5.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.i

Protein Sequence (268 amino acids)

>OKFHMN_16530 nickel import ATP-binding protein NikE (Escherichia coli ECRC100)
MTLLNVSDLSHHYAHGGFSGKHQHQAVLNNVSLTLKSGETVALLGRSGCGKSTLSRLLVG
LESPSQGNISWRGESLAKLNRAQRKAFRRDIQMVFQDSISAVNPRKTVREILREPMRHLL
SLKKSEQLARASEMLHAVDLDDSVLDKRPPQLSGGQLQRVCLARALAVEPKLLILDEAVS
NLDLVLQAGVIRLLKKLQQQFGTACLFITHDLRLVERFCQRVMVMDNGQIVETQAVGEKL
TFSSDAGRVLQNAILPAFPVRRRATEKV