Protein Info for OKFHMN_16070 in Escherichia coli ECRC100

Name: lpfC
Annotation: putative outer membrane usher protein LpfC'

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 PF00577: Usher" amino acids 1 to 393 (393 residues), 460.1 bits, see alignment E=1.3e-141 PF13953: PapC_C" amino acids 402 to 469 (68 residues), 74.3 bits, see alignment E=5.6e-25

Best Hits

Swiss-Prot: 100% identical to LPFC2_ECO57: Probable outer membrane usher protein LpfC' (lpfC') from Escherichia coli O157:H7

Predicted SEED Role

"type 1 fimbriae anchoring protein FimD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (485 amino acids)

>OKFHMN_16070 putative outer membrane usher protein LpfC' (Escherichia coli ECRC100)
VPIFQREGHLKYSFAAGEYQAGNYDSASPRFGQLDLIYGLPWGMTAYGGVLISNNYNAFT
LGIGKNFGYIGAISIDVTQAKSELNNDRDSQGQSYRFLYSKSFESGTDFRLAGYRYSTSG
FYTFQEATDVRSDADSDYNRYHKRSEIQGNLTQQLGAYGSVYLNLTQQDYWNDAGKQNTV
SAGYNGRIGKVSYSIAYSWNKSPEWDESDRLWSFNISVPLGRAWSNYRVTTDQDGRTNQQ
VGVSGTLLEDRNLSYSVQEGYASNGVGNSGNANVGYQGGSGNVNVGYSYGKDYRQLNYSV
RGGVIVHSEGVTLSQPLGETMTLISVPGARNARVVNNGGVQVDWMGNAIVPYAMPYRENE
ISLRSDSLGDDVDVENAFQKVVPTRGAIVRARFDTRVGYRVLMTLLRSAGSPVPFGATAT
LITDKQNEVSSIVGEEGQLYISGMPEEGRVLIKWGNDASQQCVAPYKLSLELKQGGIIPV
SANCQ