Protein Info for OKFHMN_15870 in Escherichia coli ECRC100

Name: yiaW
Annotation: Inner membrane protein YiaW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details PF11742: DUF3302" amino acids 3 to 78 (76 residues), 146.4 bits, see alignment E=1.1e-47

Best Hits

Swiss-Prot: 100% identical to YIAW_ECO57: Inner membrane protein YiaW (yiaW) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b3587)

Predicted SEED Role

"GTPase (EC 3.6.1.-)" (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (107 amino acids)

>OKFHMN_15870 Inner membrane protein YiaW (Escherichia coli ECRC100)
MFLDYFALGVLIFVFLVIFYGIIILHDIPYLIAKKRNHPHADAIHVAGWVSLFTLHVIWP
FLWIWATLYRPERGWGMQSHDSSVMQLQQRIAGLEKQLADIKSSSAE