Protein Info for OKFHMN_15330 in Escherichia coli ECRC100

Name: escC
Annotation: type III secretion system LEE outer membrane ring protein EscC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR02516: type III secretion outer membrane pore, YscC/HrcC family" amino acids 32 to 507 (476 residues), 613 bits, see alignment E=1.5e-188 PF21304: T3S_SPI-1_N0" amino acids 36 to 101 (66 residues), 32.6 bits, see alignment E=1.2e-11 PF03958: Secretin_N" amino acids 180 to 275 (96 residues), 54.4 bits, see alignment E=1.7e-18 PF00263: Secretin" amino acids 336 to 504 (169 residues), 118.3 bits, see alignment E=4.1e-38

Best Hits

KEGG orthology group: K03219, type III secretion protein SctC (inferred from 100% identity to eoi:ECO111_3759)

Predicted SEED Role

"Type III secretion outermembrane pore forming protein (YscC,MxiD,HrcC, InvG)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (512 amino acids)

>OKFHMN_15330 type III secretion system LEE outer membrane ring protein EscC (Escherichia coli ECRC100)
MKKISFFIFTALFCCSAQAAPSSLEKRLGKSEYFIITKSSPVRAILNDFAANYSIPVFIS
SSVNDDFSGEIKNEKPVKVLEKLSKLYHLTWYYDENILYIYKTNEISRSIITPTYLDIDS
LLKYLSDTISVNKNSCNVRKITTFNSIEVRGVPECIKYITSLSESLDKEAQSKAKNKDVV
KVFKLNYASATDITYKYRDQNVVVPGVVSILKTMASNGSLPSTGKGAVERSGNLFDNSVT
ISADPRLNAVVVKDREITMDIYQQLISELDIEQRQIEISVSIIDVDANDLQQLGVNWSGT
LNAGQGTIAFNSSTAQANISSSVISNASNFMIRVNALQQNSKAKILSQPSIITLNNMQAI
LDKNVTFYTKVSGEKVASLESITSGTLLRVTPRILDDSSNSLTGKRRERVRLLLDIQDGN
QSTNQSNAQDASSTLPEVQNSEMTTEATLSAGESLLLGGFIQDKESSSKDGIPLLSDIPV
IGSLFSSTVKQKHSVVRLFLIKATPIKSASSE