Protein Info for OKFHMN_15260 in Escherichia coli ECRC100

Name: espG
Annotation: Type III secretion system effector EspG, GTPase activating protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 PF06872: EspG" amino acids 1 to 380 (380 residues), 674.8 bits, see alignment E=1.4e-207

Best Hits

KEGG orthology group: K12785, LEE-encoded effector EspG (inferred from 100% identity to ecf:ECH74115_5081)

Predicted SEED Role

"ROrf2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (381 amino acids)

>OKFHMN_15260 Type III secretion system effector EspG, GTPase activating protein (Escherichia coli ECRC100)
MINGLNNDSASLVLDAAMKVNSGFKKSWDEMSCAEKLFKVLSFGLWNPTYSRSERQSFQE
LLTVLEPVYPLPNELGRVSARFSDGSSLRISVTNSELVEAEIRTANNEKITVLLESNEQN
RLLQSLPIDRHMPYIQVHRALSEMDLTDTTSMRNLLGFTSKLSTTLIPHNAQTDPLSGPT
PFSSIFMDTCRGLGNAKLSLNGVDIPANAQKLLRDALGLKDTHSSPTRNVIDHGISRHDA
EQIARESSGSDKQKAEVVEFLCHPEAATAICSAFYQSFNVPALTLTHERISKASEYNAER
SLDTPNACINISISQSSDGNIYVTSHTGVLIMAPEDRPNEMGMLTNRTSYEVPQGVKCII
DEMVSALQPRYAASETYLQNT